PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G18330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 281aa    MW: 28580.6 Da    PI: 4.6219
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G18330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.6e-092102432154
                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   +++yp+ +e+e LA++ gL+ +qV++WF N R +
  OB02G18330.1 210 QCSYPKDSEKEMLAARSGLSRNQVSNWFINARVR 243
                   689*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.3E-4189251IPR001356Homeobox domain
CDDcd000864.96E-10210248No hitNo description
SuperFamilySSF466893.81E-12210255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-16211252IPR009057Homeodomain-like
PROSITE profilePS5007110.414213247IPR001356Homeobox domain
PfamPF059203.0E-12213243IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSGNPSFSQF GVDAMNGYFM AASGNGLLGA ADVPLFHPAM APPDHGGGGG FGSSGDAAAM  60
DIGVHFAANN LVLASLASQL FGSAPAAPHG HGDYVGARTP QEEEMGGGYG VAAVGDSPGA  120
VSLACLGQSD DMAVGWSSAS KKASCNWSNA GGSRTAAAVQ GSYYLARVPE AAGFVYPLDA  180
GHSAATPASE LSLSLCSNSS SDSMINAGDQ CSYPKDSEKE MLAARSGLSR NQVSNWFINA  240
RVRLWKPMIE EMCEELKRSS GASGGSQALA MEHLNSQDVI S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688521.11e-115PREDICTED: homeobox protein araucan-like
TrEMBLJ3LB160.0J3LB16_ORYBR; Uncharacterized protein
STRINGOB02G18330.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-19homeobox gene 1